Forumumuza Kayıtlı Kullanıcı Olmadığınız algılandı, Forumuntüm özelliklerini kullanabilmek için buraya tıklayarak ücretsiz üyeolabilirsiniz...
2010 2011 8. sınıf matematik kitap , dergi , deneme , günlük plan , çalışma soruları , video , olimpiyat kaynakları yaprak testleri Sınıf Panosu, Duvar Gazetesi ve Matematik Köşesi Dokümanları

Türkçe Yardım Forumu Servisi ( www.webyardim.org )

Hoşgeldiniz!, Misafir
2472 Gündür yayındayız Toplam Mesajınız: 16777215
PortalAnasayfaAramaSSSHtml Deneme AlanıTopListKayıt OlGiriş yap
logo
Kullanıcı Adı:
Duyurular!Forumunuzu SekillendirinDiger Sorunlar
Domain
Resimli Çözümler
Hitskin
Blog
Photoshop
Komedi Dükkani
OyunLar DownLoaD Sohbet CaFe A.Ö.F. Destek FlatcasT Yardım
Paylaş | 
 

 2010 2011 8. sınıf matematik kitap , dergi , deneme , günlük plan , çalışma soruları , video , olimpiyat kaynakları yaprak testleri Sınıf Panosu, Duvar Gazetesi ve Matematik Köşesi Dokümanları

Önceki başlık Sonraki başlık Aşağa gitmek 
YazarMesaj
fraktal33



Erkek
Mesaj Sayısı: 71
Kayıt tarihi: 08/03/11
Rep Puanı: 0
Rep Puanı: 710

MesajKonu: 2010 2011 8. sınıf matematik kitap , dergi , deneme , günlük plan , çalışma soruları , video , olimpiyat kaynakları yaprak testleri Sınıf Panosu, Duvar Gazetesi ve Matematik Köşesi Dokümanları   C.tesi Mart 12, 2011 12:05 am

8. sınıf matematik kaynakları (Kitap+soru bankası+yaprak test+çeşitli dökümanlar)

Sınıf Panosu, Duvar Gazetesi ve Matematik Köşesi Dokümanları Akıl Oyunları, Süper Zeka Soruları

Sınıf Panosu, Duvar Gazetesi ve Matematik Köşesi Dokümanları Akıl Oyunları, Süper Zeka Soruları
Akıl oyunları ve çözümleri 235 sayfa
Süper zeka soruları ve çözümleri 340 sayfa
Pano için zeka soruları ve çözümleri 25 haftalık
Pano için matematik afişleri

hotfile.comhotfile.com zekasorularipanoicinveakiloyunlarivesuperzekasorularivematematikafisleri4.rar.html


2010 2011 8. sınıf matematik kitap kaynakları


8. Sınıf Bay Yayıncılık Geometri Matematik Konu Anlatımlı Kitabı
350 sayfa

2 partı indiriniz 1. partı sağ tıklayıp buraya çıkart yapınız

hotfile.comhotfile.com 8snfbayyayingeometriolcmematematikkonuanlatimli.part1.rar.html

hotfile.comhotfile.com 8snfbayyayingeometriolcmematematikkonuanlatimli.part2.rar.html

8. Sınıf Coşku Yayıncılık Matematik Konu Anlatımlı Kitabı
534 sayfa

2 partı indiriniz 1. partı sağ tıklayıp buraya çıkart yapınız

hotfile.comhotfile.com 8snfcoskumatematikkonuanlatimli.part1.rar.html

hotfile.comhotfile.com 8snfcoskumatematikkonuanlatimli.part2.rar.html


8. Sınıf Zambak Yayıncılık Hücreleme 1 Matematik Konu Anlatımlı Kitabı
327 sayfa

hotfile.comhotfile.com 8snfhucrelemezambakbirincikitapmatematikkonuanlatimli.pdf.html


8. Sınıf İmza Yayıncılık Matematik Konu Anlatımlı Kitabı
363 sayfa

hotfile.comhotfile.com 8snfpergelmatematikkonuanlatimli.pdf.html

8. Sınıf Pergel Yayıncılık Matematik Konu Anlatımlı Kitabı
292 sayfa

hotfile.comhotfile.com 8snfimzamatematikkonuanlatimli.pdf.html

8. Sınıf Zambak Yayıncılık Matematik Konu Anlatımlı Kitabı
249 sayfa

hotfile.comhotfile.com 8snfzambakmatematikkonuanlatimli.pdf.html


8. Sınıf Zambak Yayıncılık Meraklısına İlk Adım Olimpiyatlara Hazırlık Matematik Konu Anlatımlı Kitabı
396 sayfa

hotfile.comhotfile.com 8snfzambakolimpiyatmatematikkonuanlatimli.pdf.html


8. Sınıf Anafen Yayıncılık Etkinlik Seti 6 , Mef , Birey Matematik Konu Anlatımlı Kitapları , Pianalitik Dergileri İlk 7 Sayı
Dosya İçerisinde 4 Ayrı Kaynak , 3 Ayrı Matematik Konu Anlatımlı Kitap Ve Pianalatik Dergileri İlk 7 Sayı
8. Sınıf Anafen Yayıncılık Etkinlik Seti 6 Matematik Konu Anlatımlı Kitabı
19 sayfa
8. Sınıf Mef Yayıncılık Matematik Konu Anlatımlı Kitabı
8 konu
8. Sınıf Birey Yayıncılık Matematik Konu Anlatımlı Kitabı
401 sayfa
8. Sınıf Pianalitik Dergileri ilk 7 sayı
7 sayı


hotfile.comhotfile.com 8snfmefvebireyveanafenetkinlikmatematikkonuanlatimivepianalitikilk7sayi.rar.html


8. Sınıf Dersanem , Hüseyin Cengiz , Çember , Meb Ders , Çalışma Matematik Konu Anlatımlı Kitapları
Dosya İçerisinde 5 Ayrı Matematik Konu Anlatımlı Kitap
7. Sınıf Dersanem Yayıncılık Matematik Konu Anlatımlı Kitabı
494 sayfa
7. Sınıf Meb Yayıncılık Ders Matematik Konu Anlatımlı Kitabı
202 sayfa
7. Sınıf Meb Yayıncılık Çalışma Matematik Konu Anlatımlı Kitabı
134 sayfa
7. Sınıf Hüseyin Cengiz Yayıncılık Matematik Konu Anlatımlı Kitabı
473 sayfa
7. Sınıf Evrensel Yayıncılık Çember Matematik Konu Anlatımlı Kitabı
36 sayfa

hotfile.comhotfile.com 8snfmebdersilecalismavedersanemvehuseyincengizvecembermatematikkonuanlatimi.rar.html


8. Sınıf Atak , Yeni Renk , Zirve Modüler Matematik Konu Anlatımlı Kitapları
Dosya İçerisinde 3 Ayrı Matematik Konu Anlatımlı Kitap
7. Sınıf Atak Yayıncılık Matematik Konu Anlatımlı Kitabı
690 sayfa
7. Sınıf Yeni Renk Yayıncılık Matematik Konu Anlatımlı Kitabı
672 sayfa
7. Sınıf Zirve Modüler Yayıncılık Matematik Konu Anlatımlı Kitabı
318 sayfa

hotfile.comhotfile.com 8snfatakveyenirenkvezirvemodulermatematikkonuanlatimi.rar.html

2010 2011 8. sınıf matematik soru bankası kaynakları


8. Sınıf Anafen Yayıncılık 11 Adımda Tüm Dersler Matematik Sbs Soru Bankası
398 sayfa

hotfile.comhotfile.com 8snf11adimdaanafentumderslermatematiksbssorubankasi.rar.html


8. Sınıf Çözüm Yayıncılık Matematik Sbs Soru Bankası
475 sayfa

hotfile.comhotfile.com 8snfcozummatematiksbssorubankasi.pdf.html


8. Sınıf İmza Yayıncılık Matematik Sbs Soru Bankası
211 sayfa

hotfile.comhotfile.com 8snfimzamatematiksbssorubankasi.pdf.html


8. Sınıf Pergel Yayıncılık Matematik Sbs Soru Bankası
279 sayfa

hotfile.comhotfile.com 8snfpergelmatematiksbssorubankasi.pdf.html


8. Sınıf Akdeniz , Guvender Tek Kitap , Dersanem Yayıncılık Matematik Sbs Soru Bankaları
Dosyanın İçerisinde 3 Adet Matematik Soru Bankası
8. Sınıf Akdeniz Yayıncılık Matematik Sbs Soru Bankası
210 sayfa
8. Sınıf Guvender Yayıncılık Tek Kitap Matematik Sbs Soru Bankası
153 sayfa
8. Sınıf Dersanem Yayıncılık Matematik Sbs Soru Bankası
118 sayfa

hotfile.comhotfile.com 8snfakdenizvedersanemveguvendertekkitapmatematiksbssorubankasi.rar.html


8. Sınıf Anafen Çalışma Kitabı 1,2 , Anafen Çalışma Kitabı 1234 , Anafen , Okulistik Yayıncılık Matematik Sbs Soru Bankaları
Dosyanın İçerisinde 5 Adet Matematik Soru Bankası
8. Sınıf Anafen Yayıncılık Çalışma Kitabı 1 Matematik Sbs Soru Bankası
49 sayfa
8. Sınıf Anafen Yayıncılık Çalışma Kitabı 2 Matematik Sbs Soru Bankası
40 sayfa
8. Sınıf Anafen Yayıncılık Matematik Sbs Soru Bankası
107 sayfa
8. Sınıf Anafen Yayıncılık Çalışma Kitabı 1,2,3,4 Matematik Sbs Soru Bankası
160 sayfa
8. SınıfOkulistik Yayıncılık Matematik Sbs Soru Bankası
1. Kitap 311 sayfa , 2. Kitap 127 sayfa

hotfile.comhotfile.com 8snfanafencalismakitabi1ve2ile1234veanafenveokluistikmatematiksbssorubankasi.rar.html


8. Sınıf Anafen Tatil Tekrar Fasikülü , Fen Bilimleri , Helikon , Zirve Modüler Yayıncılık Matematik Sbs Soru Bankaları
Dosyanın İçerisinde 4 Adet Matematik Soru Bankası
8. Sınıf Anafen Yayıncılık Tatil Tekrar Fasikülü Matematik Sbs Soru Bankası
42 sayfa
8. Sınıf Fen Bilimleri Yayıncılık Matematik Sbs Soru Bankası
303 sayfa
8. Sınıf Helikon Yayıncılık Matematik Sbs Soru Bankası
203 sayfa
8. Sınıf Zirve Yayıncılık Modüler Matematik Sbs Soru Bankası
197 sayfa

hotfile.comhotfile.com 8snfanafentatiltekrarfasikuluvefenbilimlerivezirvemodulervehelikonmatematiksbssorubankasi.rar.html


8. Sınıf Dörtrenk , Okyanus , Zambak Yayıncılık Matematik Sbs Soru Bankaları
Dosyanın İçerisinde 4 Adet Matematik Soru Bankası
8. Sınıf Dörtrenk Yayıncılık Matematik Sbs Soru Bankası
242 sayfa
8. Sınıf Okyanus Yayıncılık Matematik Sbs Soru Bankası
308 sayfa
8. Sınıf Zambak Yayıncılık Matematik Sbs Soru Bankası
153 sayfa

hotfile.comhotfile.com 8snfdortrenkveokyanusvezambakmatematiksbssorubankasi.rar.html

2010 2011 8. sınıf matematik yaprak testleri


8. Sınıf Reel Yayıncılık Matematik Yaprak Testi
49 sayfa , 24 test cevap anahtarlı

hotfile.comhotfile.com 8snfreelyayinmatematikyapraktest.rar.html


8. Sınıf Zambak ve Anafen Yayıncılık F1 Matematik Yaprak Testi
Dosyanın İçerisinde 4 Adet Matematik Yaprak Testi
6. Sınıf Anafen Yayıncılık F1Matematik Yaprak Testi
18 sayfa , 9 test cevap anahtarı her testin sonunda
7. Sınıf Anafen Yayıncılık F1Matematik Yaprak Testi
18 sayfa , 9 test cevap anahtarı her testin sonunda
8. Sınıf Anafen Yayıncılık F1Matematik Yaprak Testi
18 sayfa , 9 test cevap anahtarı her testin sonunda
8. Sınıf Zambak Yayıncılık Matematik Yaprak Testi 2010 2011
98 sayfa , 48 test cevap anahtarlı

hotfile.comhotfile.com 678snff1anafenvezambak20102011yilimatematikyapraktest.rar.html


8. Sınıf Altın Bilgi Turuncu , İmza , Zambak Yayıncılık Matematik Yaprak Testleri
Dosyanın İçerisinde 3 Adet Matematik Yaprak Testi
8. Sınıf Altın Bilgi Yayıncılık Turuncu Matematik Yaprak Testi
80 sayfa , 39 test cevap anahtarlı
8. Sınıf İmza Yayıncılık Matematik Yaprak Testi
98 sayfa , 48 test cevap anahtarlı
8. Sınıf Zambak Yayıncılık Matematik Yaprak Testi
98 sayfa , 48 test cevap anahtarlı

hotfile.comhotfile.com 8snfaltinbilgituruncuveimzavezmbakmatematikyapraktest.rar.html


8. Sınıf Anafen, Başaracağım , Coşku , Doktorum Yayıncılık Matematik Yaprak Testleri
Dosyanın İçerisinde 3 Adet Matematik Yaprak Testi
8. Sınıf Anafen Yayıncılık Matematik Yaprak Testi
60 sayfa , 30 test cevap anahtarı bir sonraki testte , son testin cevap anahtarı son testte
8. Sınıf Başaracağım Yayıncılık Matematik Yaprak Testi
93 sayfa , 46 test cevap anahtarlı
8. Sınıf Coşku Yayıncılık Matematik Yaprak Testi
162 sayfa , 32 ödev testi cevaplı , 48 kazanım kontrol testi cevap anahtarlı
8. Sınıf Doktorum Yayıncılık Matematik Yaprak Testi
64 sayfa , 31 test cevap anahtarlı

hotfile.comhotfile.com 8snfanafenvebasarcagmvecoskuvedoktormmatematikyapraktest.rar.html


8. Sınıf Batı Akademi , Eksen Ünite Tarama , Körfez , Okyanus , Özer , Sabu Yayıncılık Matematik Yaprak Testleri
Dosyanın İçerisinde 6 Adet Matematik Yaprak Testi
8. Sınıf Batı Akademi Yayıncılık Matematik Yaprak Testi
66 sayfa , 32 test cevap anahtarlı
8. Sınıf Eksen Yayıncılık Ünite Tarama Matematik Yaprak Testi
49 sayfa , 12 test cevap anahtarlı , her test 4 sayfa
8. Sınıf Körfez Yayıncılık Matematik Yaprak Testi
108 sayfa , 54 test
8. Sınıf Okyanus Yayıncılık Matematik Yaprak Testi
81 sayfa , 40 test cevap anahtarlı
8. Sınıf Özer Yayıncılık Matematik Yaprak Testi
81 sayfa , 40 test cevap anahtarlı
8. Sınıf Sabu Yayıncılık Matematik Yaprak Testi
52 sayfa , 24 test cevap anahtarlı

hotfile.comhotfile.com 8snfbatiakademiveeksenunitetaramavekorfezveokyanusveozervesabumatematikyapraktestleri.rar.html


2010 2011 8. sınıf matematik kitap , dergi , deneme , günlük plan , çalışma soruları , video , olimpiyat kaynakları yaprak testleri

8. Sınıf Coşku Denemeleri
208 sayfa , 8 adet

hotfile.comhotfile.com 8snfcoskudeneme8tane.pdf.html


8. Sınıf Anafen , Pianalitik , Check-up Denemeleri , Çalışma Yaprakları
Dosya İçerisinde Tüm Denemeler Cevap Anahtarlı
8. sınıf anafen denemeleri (2 adet)
8. sınıf pianalitik denemeleri (3 adet)
8. sınıf matematik denemeleri (7 adet)
8. sınıf check-up denemeleri (3 adet)
8. sınıf çalışma yaprakları (25 ayrı kaynaktan)

hotfile.comhotfile.com 8snfanafenvepianalaitikvecheckupdenemelerivecalismayapraklar.rar.html



8. Sınıf Coşku , Sınav , Zirve Denemeleri
Dosya İçerisinde Tüm Denemeler Cevap Anahtarlı
8. sınıf coşku denemeleri (3 adet)
8. sınıf sınav matematik denemeleri sabah gazetesinin verdiği (42 sayfa , 10 adet)
8. sınıf zirve denemeleri (5 adet)

hotfile.comhotfile.com 8snfcoskuvezirvevesinavsabahdenemeler.rar.html


8. Sınıf Faktör Denemeleri
10 adet

hotfile.comhotfile.com 8snffaktordenemeler.rar.html


8. Sınıf On Adım ve Özdebir Denemeleri ve Esen Yayınları Karekök 9 Test Cevap Anahtarlı
Dosya İçerisinde Tüm Denemeler Cevap Anahtarlı
8. sınıf faktör denemeleri (10 adet)
8. sınıf esen yayınları karekök 9 test cevap anahtarlı

hotfile.comhotfile.com 8snfonadimveozdebirdenemeleriesenkarekok9testcevapl.rar.html



8. Sınıf Zaman Denemeleri
11 adet

hotfile.comhotfile.com 8snfzamandenemeler.rar.html


8. Sınıf Zambak , Zekaküpü Denemeleri
Dosya İçerisinde Tüm Denemeler Cevap Anahtarlı
8. sınıf zambak denemeleri (4 adet)
8. sınıf zekaküpü matematik denemeleri (34 adet)


hotfile.comhotfile.com 8snfzekakupumatematikvezambakdenemeler.rar.html


Sayfa başına dön Aşağa gitmek
Kullanıcı profilini gör
 

2010 2011 8. sınıf matematik kitap , dergi , deneme , günlük plan , çalışma soruları , video , olimpiyat kaynakları yaprak testleri Sınıf Panosu, Duvar Gazetesi ve Matematik Köşesi Dokümanları

Önceki başlık Sonraki başlık Sayfa başına dön 
1 sayfadaki 1 sayfası

Bu forumun müsaadesi var:Bu forumdaki mesajlara cevap veremezsiniz
Türkçe Yardım Forumu Servisi ( www.webyardim.org ) ::  :: -
Web Site Statistics
Sitemap | İletişim | Yukarı Git
forum kurmak | © phpBB | Bedava yardımlaşma forumu | Suistimalı göstermek | Kendi blogunuzu yaratın